PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001878-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 302aa    MW: 33847.8 Da    PI: 8.8083
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001878-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.7e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv++++ +G ++Wk  ++  g++R++k+c++rw++yl
    NNU_001878-RA 13 KGPWTPDEDRKLVQCIQIHGDRRWKDLPKLAGLKRCGKSCRLRWNNYL 60
                     79*********************************************7 PP

2Myb_DNA-binding51.62.1e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE++ ++ ++  lG++ W+ Ia++++ gRt++++k++w++
    NNU_001878-RA  66 RGKFSQEEEQTILTLHSILGNK-WSEIAKKLP-GRTDNEIKNFWNT 109
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.179860IPR017930Myb domain
SuperFamilySSF466891.95E-2910107IPR009057Homeodomain-like
SMARTSM007173.0E-151262IPR001005SANT/Myb domain
PfamPF002497.2E-171360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-241467IPR009057Homeodomain-like
CDDcd001672.29E-121560No hitNo description
PROSITE profilePS5129426.39561115IPR017930Myb domain
SMARTSM007176.6E-1665113IPR001005SANT/Myb domain
PfamPF002494.5E-1566109IPR001005SANT/Myb domain
CDDcd001674.78E-1268111No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2668116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRSPSVEDG VKKGPWTPDE DRKLVQCIQI HGDRRWKDLP KLAGLKRCGK SCRLRWNNYL  60
RPDIKRGKFS QEEEQTILTL HSILGNKWSE IAKKLPGRTD NEIKNFWNTR LKKKLIKMGI  120
DPITHQPRTN FFMVQPHLLY RATSTPPEAY ELAKHQYFQC LLQTAALLMT NSSIGSMNSL  180
VLNSVLKENP VLGSPQLDDL IRFSVGTSSQ ALPSSTLSSR LPADMQLPPL NDVMDFGEIS  240
QQSPCIHPPS PLSSLPPASP VTNTIIRNQG GSRGTTSGFQ EGDISDWSEL LLDDSFICEL  300
IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-311311527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274078.10.0PREDICTED: myb-related protein MYBAS1-like
TrEMBLB9GUW12e-86B9GUW1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s09720.16e-86(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.15e-75myb domain protein 93